PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_014752-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 535aa    MW: 58682.8 Da    PI: 6.4175
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_014752-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-164087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l+++v++ G g+W+ +++  g++R++k+c++rw ++l
  AHYPO_014752-RA 40 KGPWTAAEDSILIEYVNKNGEGNWNNVMKNTGLHRCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding48.42.2e-1593136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE++ ++++++q+G++ W++ a +++ gRt++++k++w++
  AHYPO_014752-RA  93 KGAFTKEEEDEIIRLHAQFGNK-WARMATKLP-GRTDNEIKNFWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7263587IPR017930Myb domain
SuperFamilySSF466891.01E-2839134IPR009057Homeodomain-like
SMARTSM007174.6E-143989IPR001005SANT/Myb domain
PfamPF002492.7E-144087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-224194IPR009057Homeodomain-like
CDDcd001671.77E-104287No hitNo description
PROSITE profilePS5129423.25988142IPR017930Myb domain
SMARTSM007171.6E-1592140IPR001005SANT/Myb domain
PfamPF002495.1E-1493136IPR001005SANT/Myb domain
CDDcd001671.74E-1195136No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2395140IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MIEMKSDSEK RKTARCRKNS PGAEEVSSGG SSSGGVILKK GPWTAAEDSI LIEYVNKNGE  60
GNWNNVMKNT GLHRCGKSCR LRWANHLRPE LKKGAFTKEE EDEIIRLHAQ FGNKWARMAT  120
KLPGRTDNEI KNFWNTRIKR MQRSGKPVYP TSCQPTNENL QSDDKMSCQN LDGHHSEDQL  180
TNCVPIPEVQ LHLLGLNQKY LNCSQPLLDL IPSTSLSSSG SYEFPFPAMN PRKRFREVDS  240
PFSSISNAYA SCDPHEGRPA PGQPLWSTPL CDTGLNINQT SSIDVLGSHA FITNGNSSSC  300
EPDSCAMKLE LPSLQCSTPQ VGSRDARLPL FPSFESVDPV IQPPLSKPTQ SICLSPRRNG  360
MLEAIVYESQ KKSNCNSEQQ ISDPSAFVGA GAVSSSQNVC ETKQLLYCDP ISPLSPSAAS  420
DFPEYTSGSG LNSPDEPLSG TNIKRETVDA KQDLSSSLGC IRPDALLNYF CLYTPIGFRK  480
DYSIIDDVGA GPLLVLGDDL SREYKQPGAQ PSDESIMSRC SNSLWDSSPQ VHRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29381405106B-MYB
1h8a_C7e-293814025126MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010673832.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_010673831.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_010673830.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0J8CRM20.0A0A0J8CRM2_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.12e-67myb domain protein 81